PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA18G00067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 1705aa    MW: 187690 Da    PI: 7.5628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA18G00067genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.2e-10934975346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e +++  + +G++ +k+Ia+++   +t  +c+++++k
       AA18G00067 934 PWTSEEKETFLNKLASYGKD-FKKIASYLT-QKTTADCIEYYYK 975
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding26.61.4e-0811491190447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++++r++g +R+  qc+ ++ k+
       AA18G00067 1149 WTDDERSAFIQGFSLYGKN-FALVSRYIG-TRSQDQCRVFFSKV 1190
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.04E-14917979IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-7926976IPR009057Homeodomain-like
PROSITE profilePS5129316.087930981IPR017884SANT domain
SMARTSM007172.3E-8931979IPR001005SANT/Myb domain
PfamPF002499.4E-8933975IPR001005SANT/Myb domain
CDDcd001679.58E-7934976No hitNo description
PROSITE profilePS5129312.16711441195IPR017884SANT domain
SMARTSM007173.2E-711451193IPR001005SANT/Myb domain
SuperFamilySSF466894.52E-911481195IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-411481189IPR009057Homeodomain-like
PfamPF002494.7E-711491189IPR001005SANT/Myb domain
CDDcd001677.17E-611491190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1705 aa     Download sequence    Send to blast
DSGLVLLNGS LVRLHLVSVV TDSGVDSRLL YAIVLDNLMP QDHASWDRKE LLRQRKHERP  60
EQSFDSAFRW RESPSTPSSH HVSREFSRWG SGDFRRPSCK TLPSFFYRYG KQGGGRNQFV  120
DDASHAYTSS RSGTRMLEND YYRSSASRGD WRYTRNGRDD RISLSHKEWK CNTWEMSNGS  180
SRSFERSCGI KNGRRSVDER PPHASETHNP LSNSGDPANT AYQPDIKVCT PSRTLKVKSD  240
QKFPDQRLSL LSDPHSDSVN LCVRPCSEKK SGNKTFSPVK QCSDIISGQR LANDSSLDPS  300
VPQAGLEDTW GQLHVQDPHD DKLHGTSDLD VSRKYTKDSS VGAVGKCSLW TRSGSFASRG  360
SGFSHSSSSK SMGAVDSNDW KNEILPKNVA VAQSSSGDAA ACITTTHMSE DLSSRKKPRL  420
GWGEGLAKYE KKKVDVNTNE DGTPLLENRT EEMHSLEKSA VDKSPTVGIV QDYGSPATPS  480
SMACSSSLGT IHFINHIFVL LSRFAEKSSA KAVIASNDTS NMCRSPSPVS SVQGVSSVQL  540
ERIPINIEEL DDISMGRISC LLNELLGTDD SGSGDSSSVQ LTAVNRLLAW KADILKAVEM  600
YESEIDLREN ECKMIKLEDG RYHCHVGPSS HHCEGNANVP KEQEAPCTST VRAEASFVAE  660
TVVRTPFLPS VLAEVPVESS CGAVEALSQS PTSAQISKDI LHIPSINVDA SSKEINSSAT  720
VNQETIQLSS GDYMDCDEDL TYANILDSNK KSASEASEVF NDLLPREISC FDDSRSSGLC  780
QSEFESHIKE KVADRIELLR AREKILFLQF KAFQLAWKKD LQQLAMTKYQ SKSSKKTELY  840
LHAKYNGHLK LPQSVRPRFS SPAPRRSSLA PTTELISYME KLLPSTHLKP FRDTLKMPAM  900
ILDEKERVSL RFISTNGLIE DPCDVEKEKT MINPWTSEEK ETFLNKLASY GKDFKKIASY  960
LTQKTTADCI EYYYKNHKSD SFGKIKKQRA YGKEGKHTYM LAPRKKWKRD MGAGSLDILG  1020
AVSMIAANAG KAASTKQISS KRITLRGCSS SSSFQHDGNN SEGCSYSFDF PHKKPIGADT  1080
LAVGPVSSEQ MNSCLKTSSS SKKRCMDHLK FDPVVKKPRI SHTAHIENNN EEDDSYSEES  1140
CGETGPIHWT DDERSAFIQG FSLYGKNFAL VSRYIGTRSQ DQCRVFFSKV RKCLGLESIQ  1200
FGSGIVSTSA SVDNGNEGGG SDLEYPCALE SSSGICKMDM NSPTSPFNIN HDGSNHSDSA  1260
NVKVDLGRSD QENGLAYLRF KDNTNLVKDP YFNGTIPGLV SESSRDLVNI KTVENQAAEK  1320
IKNNDLPSLE TKEGTLTSVA VSSEPSSCGP SVLANVVMEN PTESSRKGFG VQGFVLPKQN  1380
SKNHDAVMQA PNRIRNSGLE AEAAPLGFRY PECLHHVPIQ LCMEDPVGVS LPRGNPNYRT  1440
EFESSNSFVG QVFERHNLGL QSSNVNLDPD GRFQLLGHAN HDLSDQLKTS NPKSCQITRI  1500
SFTQDPSKIS RSKSDLIVKT QRTGEGFSLI KCGGLSSNGG SAKPLSVSYK NGRSGHNRSH  1560
SCSLSDREKP DKSGDVKLFG TILTAHENGS NSKHHKHNQC GTINTINAEH TLQNVPIMSY  1620
DGLWDGNRIR TGLTSLPEST KSLARYPEAF STPIEQQIGS SKEMLQQLHR KPNVSVKQAD  1680
HNKIDAMNAK DAGNIGVDGV AEAIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C7e-17892982493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D7e-17892982493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876132.10.0myb family transcription factor
TrEMBLD7LU400.0D7LU40_ARALL; Myb family transcription factor
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein